PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G26010.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 809aa    MW: 87582.2 Da    PI: 6.0076
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G26010.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.8e-20104160157
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  OGLUM04G26010.2 104 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 160
                      688999************************************************995 PP

2START204.25.2e-642945191206
                      HHHHHHHHHHHHHHHHC-TT-EEEE.........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-S CS
            START   1 elaeeaaqelvkkalaeepgWvkss.........esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetla 77 
                      ela +a++elv++a+++ep+W+  +         e + ++e+ + f+++ +      ++ea+r+s+vv+m++a+lve+l+d ++    +++ + 
  OGLUM04G26010.2 294 ELAVAAMEELVRMAQLDEPLWSVAPpldaaaaamETLSEEEYARMFPRGLGpkqygLRSEASRDSAVVIMTHANLVEILMDANQyaaVFSNIVS 387
                      57899********************9*9999999999999999999887779*******************************66666666666 PP

                      EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
            START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                      +a tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+ds ++ p    v +++++pSg+li++++ng+skv
  OGLUM04G26010.2 388 RAVTLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNADGTWAVVDVSLDSLRPSP----VLKCRRRPSGCLIQEMPNGYSKV 477
                      *****************************************************************98....7********************** PP

                      EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      twvehv++++r++h++++ lv+sgla+ga++wv tl+rqce+
  OGLUM04G26010.2 478 TWVEHVEVDDRSVHNIYKLLVNSGLAFGARRWVGTLDRQCER 519
                      ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-2284159IPR009057Homeodomain-like
SuperFamilySSF466897.1E-2091161IPR009057Homeodomain-like
PROSITE profilePS5007117.07101161IPR001356Homeobox domain
SMARTSM003892.3E-20102165IPR001356Homeobox domain
CDDcd000861.43E-19103162No hitNo description
PfamPF000464.4E-18104159IPR001356Homeobox domain
PROSITE patternPS000270136159IPR017970Homeobox, conserved site
PROSITE profilePS5084841.731285522IPR002913START domain
SuperFamilySSF559611.06E-34287521No hitNo description
CDDcd088753.62E-119289518No hitNo description
SMARTSM002349.5E-59294519IPR002913START domain
PfamPF018524.7E-54295519IPR002913START domain
Gene3DG3DSA:3.30.530.205.0E-6359515IPR023393START-like domain
SuperFamilySSF559614.21E-12540755No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MMIPARHMPS MIGRNGAAYG SSSALSLSQP NLLDNHQFQQ AFQHQQQQHH LLDQIPATTA  60
ESGDNMIRSR ASDPLGDEFE SKSGSENVDG VSVDDQDPNQ RPRKKRYHRH TQHQIQEMEA  120
FFKECPHPDD KQRKELSREL GLEPLQVKFW FQNKRTQMKN QHERHENSQL RSDNEKLRAE  180
NMRYKEALSS ASCPNCGGPA ALGEMSFDEH HLRIENARLR EEIDRISAIA AKYVGKPMVP  240
FPVLSNPMAA AASRAPLDLP VAPYGVPGDM FGGGGAGELL RGVQSEVDKP MIVELAVAAM  300
EELVRMAQLD EPLWSVAPPL DAAAAAMETL SEEEYARMFP RGLGPKQYGL RSEASRDSAV  360
VIMTHANLVE ILMDANQYAA VFSNIVSRAV TLEVLSTGVA GNYNGALQVM SVEFQVPSPL  420
VPTRESYFVR YCKQNADGTW AVVDVSLDSL RPSPVLKCRR RPSGCLIQEM PNGYSKVTWV  480
EHVEVDDRSV HNIYKLLVNS GLAFGARRWV GTLDRQCERL ASVMASNIPT SDIGVITSSE  540
GRKSMLKLAE RMVVSFCGGV TASVAHQWTT LSGSGAEDVR VMTRKSVDDP GRPPGIVLNA  600
ATSFWLPWDI LSNGGIVQEM AHIANGRDQG NCVSLLRVNS SNSNQSNMLI LQESCTDASG  660
SYVIYAPVDV VAMNVVLNGG DPDYVALLPS GFAILPDGPA HDGGGGDGGV GVGSGGSLLT  720
VAFQILVDSV PTAKLSLGSV ATVNSLIACT VERIKAAVSG ESNPQSSKIL ELSSVGSQER  780
TSDCPCHVFF LAASMKAMLI SVSSSGRVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016450.0AB101645.1 Oryza sativa Japonica Group Roc2 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636338.10.0PREDICTED: homeobox-leucine zipper protein ROC2 isoform X1
RefseqXP_015636339.10.0PREDICTED: homeobox-leucine zipper protein ROC2 isoform X1
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLA0A0D9ZR250.0A0A0D9ZR25_9ORYZ; Uncharacterized protein
STRINGLOC_Os04g53540.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2